PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV44852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CAMTA
Protein Properties Length: 121aa    MW: 14393.7 Da    PI: 9.9202
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV44852.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1152.78.2e-48111162108
        CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcyw 100
                 ++ k+rwl+++ei+aiL nf+ +++  ++ + pksg+++L++rk++r+frkDGy+wkkkkdgktv+E+he+LKvg+ e +++yYah+e+ ptf rrcyw
  KZV44852.1  11 VEAKARWLRPNEIHAILCNFKYFTVNVKPVNLPKSGTIVLFDRKMFRNFRKDGYKWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYW 109
                 6779*********************************************************************************************** PP

        CG-1 101 lLeeelek 108
                 lL++  e+
  KZV44852.1 110 LLDKY-EN 116
                 **987.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143763.4026121IPR005559CG-1 DNA-binding domain
SMARTSM010761.1E-609118IPR005559CG-1 DNA-binding domain
PfamPF038591.3E-4112115IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
LIDLDVGAIM VEAKARWLRP NEIHAILCNF KYFTVNVKPV NLPKSGTIVL FDRKMFRNFR  60
KDGYKWKKKK DGKTVKEAHE HLKVGNEERI HVYYAHGEDS PTFVRRCYWL LDKYENTNTF  120
C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547365.14e-66PREDICTED: calmodulin-binding transcription activator 5-like
RefseqXP_008223308.14e-66PREDICTED: calmodulin-binding transcription activator 5-like isoform X1
SwissprotO234631e-59CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLI1MGH05e-66I1MGH0_SOYBN; Uncharacterized protein
STRINGGLYMA15G15350.11e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14489811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.11e-55calmodulin binding;transcription regulators